speakenglishwithtiffaniacademy.com valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
User-agent: * Disallow: /secure/ Disallow: /admin/ Disallow: /manage/ Disallow: /workers/ Disallow: /analytics/ | ||
Meta Tags
| Title | LET’S JUMP RIGHT IN! | Speak English With Tiffani |
| Description | The #1 Online English LOGIN The #1 Online English Academy Find English courses and resources that will help you finally speak English fluently and with confidence. LET’S JUMP R |
| Keywords | N/A |
Server Information
| WebSite | |
| Host IP | 172.67.189.99 |
| Location | United States |
Related Websites
| Site | Rank |
More to Explore
speakenglishwithtiffaniacademy.com Valuation
|
US$3,464,442
Last updated: 2022-06-17 19:43:21
speakenglishwithtiffaniacademy.com has Semrush global rank of 3,055,125. speakenglishwithtiffaniacademy.com has an estimated worth of US$ 3,464,442, based on its estimated Ads revenue. speakenglishwithtiffaniacademy.com receives approximately 399,744 unique visitors each day. Its web server is located in United States, with IP address 172.67.189.99. According to SiteAdvisor, speakenglishwithtiffaniacademy.com is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$3,464,442 |
| Daily Ads Revenue | US$3,198 |
| Monthly Ads Revenue | US$95,939 |
| Yearly Ads Revenue | US$1,151,261 |
| Daily Unique Visitors | 26,650 |
| Note: All traffic and earnings values are estimates. | |
DNS Records
| Host | Type | TTL | Data |
| speakenglishwithtiffaniacademy.com. 299 | A | IP: 172.67.189.99 | |
| speakenglishwithtiffaniacademy.com. 299 | A | IP: 104.21.57.68 | |
| speakenglishwithtiffaniacademy.com. 299 | AAAA | IPV6: 2606:4700:3031::6815:3944 | |
| speakenglishwithtiffaniacademy.com. 299 | AAAA | IPV6: 2606:4700:3031::ac43:bd63 | |
| speakenglishwithtiffaniacademy.com. 86400 IN NS | NS | NS Record: dilbert.ns.cloudflare.com. | |
| speakenglishwithtiffaniacademy.com. 86400 IN NS | NS | NS Record: zara.ns.cloudflare.com. | |
| speakenglishwithtiffaniacademy.com. 300 | MX | MX Record: 20 eforward5.registrar-servers.com. | |
| speakenglishwithtiffaniacademy.com. 300 | MX | MX Record: 10 eforward1.registrar-servers.com. | |
| speakenglishwithtiffaniacademy.com. 300 | MX | MX Record: 10 eforward2.registrar-servers.com. | |
| speakenglishwithtiffaniacademy.com. 300 | MX | MX Record: 10 eforward3.registrar-servers.com. | |
| speakenglishwithtiffaniacademy.com. 300 | MX | MX Record: 15 eforward4.registrar-servers.com. | |
| speakenglishwithtiffaniacademy.com. 300 | TXT | TXT Record: v=spf1 include:spf.efwd.registrar-servers.com ~all |
HtmlToTextCheckTime:2022-06-17 19:43:21
| LOGIN The #1 Online English Academy Find English courses and resources that will help you finally speak English fluently and with confidence. LET’S JUMP RIGHT IN! Daily English Lessons Membership [$30/Month] Do you want to have a daily English study plan that will help you speak English fluently? Then this monthly membership is for you! This membership will take your English to the next level. ENROLL NOW Learn More Speak English Like a Native Course [$299] Have you always wanted to sound like a native English speaker? Then this course is for you! This course will show you how to finally speak fluently and with confidence like a native English speaker. ENROLL NOW Learn More Master English Slang Course [$199] Do you want to use real English slang when you have conversations with native English speakers? Then this course is for you! This course will explain some of the most popular English slang and teach you how to use them properly. ENROLL NOW Learn More Weekly English Words Membership |
HTTP Headers
HTTP/1.1 301 Moved Permanently
Date: Fri, 22 Oct 2021 07:57:17 GMT
Connection: keep-alive
Cache-Control: max-age=3600
Expires: Fri, 22 Oct 2021 08:57:17 GMT
Location: https://speakenglishwithtiffaniacademy.com/
Vary: Accept-Encoding
Set-Cookie: __cfruid=8eccfee246bbf4d8470e1d0ec178399ec5f16660-1634889437; path=/; domain=.speakenglishwithtiffaniacademy.com; HttpOnly
CF-Cache-Status: DYNAMIC
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v3?s=Phmi0QatXYF15SzRQIUqQfl3rk0u4PHUsVC%2FJv2Fk%2F310IFafsFQ9N6IP7GL9nP7tfUDCDSv1sW4Itdg5EzycjhU%2BdPE0QwBqHn1qag3jK%2BNoWVNPfs%2BaCf8u2mkxrcIzlCNWP%2BSCQ2%2BxY8UQ%2BsbxbNLzBtu"}],"group":"cf-nel","max_age":604800}
NEL: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 6a212c8788a9634e-ORD
alt-svc: h3=":443"; ma=86400, h3-29=":443"; ma=86400, h3-28=":443"; ma=86400, h3-27=":443"; ma=86400
HTTP/2 200
date: Fri, 22 Oct 2021 07:57:17 GMT
content-type: text/html; charset=utf-8
x-fedora-school-id: 76970
cache-control: max-age=0, private, must-revalidate
set-cookie: ahoy_visitor=2bec54d1-7c4f-4156-bc45-7b33a39addaa; path=/; expires=Sun, 22 Oct 2023 07:57:17 GMT; secure
x-request-id: 76c842a9-243b-4015-ab87-9a3e0e718ebf
x-runtime: 0.150217
vary: Accept-Encoding
strict-transport-security: max-age=0
x-frame-options: SAMEORIGIN
x-content-type-options: nosniff
x-xss-protection: 1; mode=block
x-download-options: noopen
x-permitted-cross-domain-policies: none
referrer-policy: strict-origin-when-cross-origin
cf-cache-status: DYNAMIC
expect-ct: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
set-cookie: ahoy_visit=050dab44-81c7-4f1a-8096-7a18d219108c; path=/; expires=Fri, 22 Oct 2021 11:57:17 GMT; secure
set-cookie: request_method=HEAD; path=/; secure
set-cookie: _afid=2bec54d1-7c4f-4156-bc45-7b33a39addaa; domain=.speakenglishwithtiffaniacademy.com; path=/; expires=Sat, 22 Oct 2022 07:57:17 GMT; secure
set-cookie: aid=2bec54d1-7c4f-4156-bc45-7b33a39addaa; domain=.speakenglishwithtiffaniacademy.com; path=/; expires=Sat, 22 Oct 2022 07:57:17 GMT; secure
set-cookie: site_preview=logged_out; path=/; secure; HttpOnly
set-cookie: _session_id=4074cc6ea9d8771241ae71562eb82f4f; path=/; expires=Sun, 21 Nov 2021 07:57:17 GMT; HttpOnly; secure
set-cookie: __cfruid=8eccfee246bbf4d8470e1d0ec178399ec5f16660-1634889437; path=/; domain=.speakenglishwithtiffaniacademy.com; HttpOnly; Secure; SameSite=None
report-to: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v3?s=qQMuPg%2FpH0I0AANXSMvnSbByPQiJ0vSkmiXw%2BWHtLnr0lEeaglgwwt8LCubPWO0g8exacZFtKmdmqszx22EvBEqgMUP5CGWNwhmO68K3hRC9Pjan%2B3%2FAfl%2Bc6al1usJYhwD0e2eSPlvdQ4neOmz5e00fnlV6"}],"group":"cf-nel","max_age":604800}
nel: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
server: cloudflare
cf-ray: 6a212c87e80c2962-ORD
alt-svc: h3=":443"; ma=86400, h3-29=":443"; ma=86400, h3-28=":443"; ma=86400, h3-27=":443"; ma=86400
|
speakenglishwithtiffaniacademy.com Whois Information
Domain Name: SPEAKENGLISHWITHTIFFANIACADEMY.COM Registry Domain ID: 2339788521_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.namecheap.com Registrar URL: http://www.namecheap.com Updated Date: 2020-11-04T07:58:52Z Creation Date: 2018-12-04T11:15:30Z Registry Expiry Date: 2021-12-04T11:15:30Z Registrar: NameCheap, Inc. Registrar IANA ID: 1068 Registrar Abuse Contact Email: abuse@namecheap.com Registrar Abuse Contact Phone: +1.6613102107 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: DILBERT.NS.CLOUDFLARE.COM Name Server: ZARA.NS.CLOUDFLARE.COM DNSSEC: unsigned >>> Last update of whois database: 2021-09-10T23:35:33Z <<< |